For Science… From Science
1-888-343-5974

APP, A4, AD1

Catalog Number: BP22-746

Protein Name: Amyloid beta A4 protein; ABPP; APPI; Short=APP; Alzheimer disease amyloid protein; Amyloid precursor protein; Beta-amyloid precursor protein; Cerebral vascular amyloid peptide; Short=CVAP; PreA4; Protease nexin-II; Short=PN-II; Contains: N-APP; Contains:

UniProt ID: P05067

Amount: 25nmol

Sequence (1 Letter Code): H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH

$399.00

Testimonials

"Seriously, your customer service is sooo much better than that other company!"
Brian J. PhD - University of Washington