Bioactive peptides

NEP offers thousands of high quality, high purity bioactive peptides.  All of our bioactive peptides have gone through rigorous testing and include HPLC purities of >95% and Mass Spectral analysis.  Below is an alphabetical list of all of our bioactive peptides. 

To search use the search box (upper right):

BY KEYWORD: enter a keyword, example:  "Beta Amyloid" or "MOG"

BY PEPTIDE SEQUENCE:  enter peptide sequence or sequence fragment in 1 letter code, example:  "DAEF"

BY CATALOG NUMBER:  enter catalog number

Sub Categories

Beta-Amyloid Peptides

Histone Peptides

Products

Chain A, Covalent Glycosyl-Enzyme Intermediate Of Hen Egg White Lysozyme

Sequence: H2N-VFGRCELAAAMKRHG-OH
Amount: 1mg
Catalog: BP10-200

$80.00

Chain A, New B-Chain Mutant Of Bovine Insulin

Sequence: H2N-LVEALYLVSGERG-OH
Amount: 1mg
Catalog: BP10-205

$80.00

Chain B, The Insulin Receptor Kinase acetyl/amide

Sequence: Ac-TGDFMNMS-amide
Amount: 1mg
Catalog: BP10-210

$60.00

chorismate mutase (54-59) [Clostridium tetani E88]

Sequence: H2N-AYPGKF-OH
Amount: 1mg
Catalog: BP12-078

$80.00

chromosome 10 open reading frame 7 fragment Aminohexanoic acid/Biotinyl/amide [Homo sapiens]

Sequence: H2N-AEFR(Ahx)(CPEOBiotin)-amide
Amount: 1mg
Catalog: BP12-079

$160.00

Chromosome 14 open reading frame 143 (81-87) [Homo sapiens]

Sequence: H2N-NIVRKKK-OH
Amount: 1mg
Catalog: BP12-080

$80.00

cluster of differentiation 2 (281-290) [Multiple species]

Sequence: H2N-HPPPPPGHRS-OH
Amount: 1mg
Catalog: BP12-081

$80.00

CMX-8933

Sequence: Ac-KKETLQFRC-amide
Amount: 1mg
Catalog: BP13-005

$100.00

coagulation factor II (thrombin) B chain fragment [Homo sapiens]

Sequence: H2N-KPVAFSDYIHPVCLPDR-OH
Amount: 1mg
Catalog: BP12-082

$80.00

Coagulation factor II peptide; prothrombin (474-477) [Mus musculus]

Sequence: H2N-YIHP-OH
Amount: 1mg
Catalog: BP10-220

$60.00

complement C3 precursor (1311-1320) [Homo sapiens]

Sequence: H2N-IHWESASLLR-OH
Amount: 1mg
Catalog: BP12-083

$80.00

complement C3 precursor fragment [Homo sapiens]/[Sus scrofa]

Sequence: H2N-NTLIIYLDK-OH
Amount: 1mg
Catalog: BP12-084

$80.00

complement C4 precursor fragment [Homo sapiens]

Sequence: H2N-RGHLFLQTDQPIYNPGQR-OH
Amount: 1mg
Catalog: BP12-085

$160.00

complement factor B fragment [Multiple species]

Sequence: H2N-DFHINLFQVLPWLK-OH
Amount: 1mg
Catalog: BP12-087

$80.00

Connexin 43 Fragment

Sequence: H2N-SRPTEKT-OH
Amount: 1mg
Catalog: BP10-225

$60.00

Conserved hypothetical membrane protein (579-583) 5FAM/Biotinyl/amide [Thermoplasma acidophilum]

Sequence: 5FAM-LIMVVVLM(KLCBiot)-amide
Amount: 1mg
Catalog: BP10-230

$160.00

CREB327 (113-126) pSer119 Biotinyl [Homo sapiens]

Sequence: LCBiot-ILSRRP(pS)YRKILND-OH
Amount: 1mg
Catalog: BP10-235

$160.00

CREB327/active transcription factor CREB-A (113-126) Biotinyl [Homo sapiens]

Sequence: LCBiot-ILSRRPSYRKILND-OH
Amount: 1mg
Catalog: BP12-091

$120.00

CREB327/active transcription factor CREB-A (113-126) [Homo sapiens]

Sequence: H2N-ILSRRPSYRKILND-OH
Amount: 1mg
Catalog: BP10-240

$80.00

CREB327/active transcription factor CREB-A (113-126)5FAM/amide [Homo sapiens]

Sequence: 5FAM-ILSRRPSYRKILND-amide
Amount: 1mg
Catalog: BP12-092

$120.00

Crk-associated substrate (pTyr 237) (234-242) [Mus musculus]

Sequence: H2N-EQDE(pY)DTPR-OH
Amount: 1mg
Catalog: BP10-245

$160.00

Crotamine [Crotalus durissus terrificus] 1-42

Sequence: H2N-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
Amount: 1mg
Catalog: BP10-250

$240.00

Cyclic AMP-responsive element modulator; CREM (110-122) Biotinyl [Homo sapiens]

Sequence: LCBiot-KRREILSRRPSYR-OH
Amount: 1mg
Catalog: BP10-255

$120.00

Cyclin D1

Sequence: H2N-LLGATCMFV-OH
Amount: 1mg
Catalog: BP10-260

$60.00

Cyclin dependent kinase 2 (6-20)

Sequence: H2N-KVEKIGEGTYGVVYK -OH
Amount: 1mg
Catalog: BP10-265

$80.00

Cyclin dependent kinase inhibitor 2A - Tumor Suppressor

Sequence: H2N-MVRRFLVTLRIRRACGPPRV -OH
Amount: 1mg
Catalog: BP10-270

$80.00

Cyclin-dependent kinase fragment (151-169) 5FAM/amide [Homo sapiens]

Sequence: 5FAM-(bA)PGDSQGRKRRQTSMTDFYH-amide
Amount: 1mg
Catalog: BP10-275

$160.00

Cyclin-dependent kinase fragment (151-173) 5FAM [Homo sapiens]

Sequence: 5FAM-(bA)PGDSQGRKRRQTSMTDFYHSKRR-OH
Amount: 1mg
Catalog: BP10-280

$160.00

Cyclin-dependent kinase fragment (155-173) Biotinyl [Homo sapiens]

Sequence: LCBiot-QGRKRRQTSMTDFYHSKRR-OH
Amount: 1mg
Catalog: BP10-285

$120.00

Cyclin-dependent kinase inhibitor 1A (134-156) Biotinyl [Homo sapiens]

Sequence: LCBiot-PGDSQGRKRRQTSMTDFYHSKRR-OH
Amount: 1mg
Catalog: BP10-290

$120.00

Cyclin-dependent kinase inhibitor 1A (P21) (129-151) Biotinyl [Mus musculus]

Sequence: LCBiot-PGTSQGRKRRQTSMTDFYHSKRR-OH
Amount: 1mg
Catalog: BP10-295

$120.00

Cys 10-His

Sequence: H2N-CHHHHHHHHHH-OH
Amount: 1mg
Catalog: BP11-300

$100.00

Cys 6-His

Sequence: H2N-CHHHHHH-OH
Amount: 1mg
Catalog: BP11-290

$100.00

Cystic fibrosis transmembrane conductance regulator (1417-1428) Biotinyl

Sequence: LCBiot-IEENKVRQYDSI-OH
Amount: 1mg
Catalog: BP10-300

$120.00

Cytochrome c - pigeon (88-104)

Sequence: H2N-KAERADLIAYLKQATAK-OH
Amount: 1mg
Catalog: BP10-305

$120.00

Cytochrome c fragment (93-108)

Sequence: H2N-ANERADLIAYLKQATK-OH
Amount: 1mg
Catalog: BP10-310

$120.00

Cytochrome P450 CYP1B1 (190-198) [Homo sapiens]

Sequence: H2N-FLDPRPLTV-OH
Amount: 1mg
Catalog: BP10-315

$80.00

DNA repair protein RAD2 (329-336) [Archaeoglobus fulgidus]

Sequence: H2N-QATLERWF-OH
Amount: 1mg
Catalog: BP12-107

$80.00

DNA-directed RNA polymerase fragment (Biotinyl) [Multiple species]

Sequence: LCBiot-PTSPSYSPTSPSYS-OH
Amount: 1mg
Catalog: BP12-108

$120.00

Doc 2 (13-37) [Homo sapiens]/[Rattus norvegicus]/[Mus musculus]

Sequence: H2N-IQEHMAINVCPGPIRPIRQISDYFP-amide
Amount: 1mg
Catalog: BP12-109

$160.00

Dopamine responsive peptide(10-15) acetyl/amide [Rattus norvegicus]

Sequence: Ac-AEEEYA-amide
Amount: 1mg
Catalog: BP10-320

$80.00

E1A binding protein p300 (73-93) Biotinyl [Rattus norvegicus]

Sequence: LCBiot-DAASKHKQLSELLRSGSSPNL-OH
Amount: 1mg
Catalog: BP10-325

$120.00

E6 protein (144-151)[human papillomavirus type 16]

Sequence: H2N-RTRRETQL-OH
Amount: 1mg
Catalog: BP12-111

$80.00

E7 protein

Sequence: H2N-LLLGTLNIV-OH
Amount: 1mg
Catalog: BP10-330

$60.00

EGF receptor substrate eps15 acetyl - [Mus musculus]/[Homo sapiens]

Sequence: Ac-QEQEDLELAIALSKSEISEA-OH
Amount: 1mg
Catalog: BP10-335

$80.00

egg white lysozyme (19-36) [Gallus gallus]

Sequence: H2N-KVFGRCELAAAMKRHGLD-OH
Amount: 1mg
Catalog: BP12-112

$160.00

ELK1, member of ETS oncogene family (377-391) Biotinyl/amide [Mus musculus]

Sequence: LCBiot-IHFWSTLSPIAPRSP-amide
Amount: 1mg
Catalog: BP10-340

$120.00

Envelope glycopeptide acetyl/amide [Human immunodeficiency virus 1]

Sequence: Ac-RILAVERYLKDQQLLGIWGCSGKLIC-amide
Amount: 1mg
Catalog: BP10-345

$120.00

envelope glycoprotein fragment Acetyl/amide[Human immunodeficiency virus 1]

Sequence: Ac-NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ-amide
Amount: 1mg
Catalog: BP12-115

$200.00

envelope glycoprotein fragment Acetyl/amide[Human immunodeficiency virus 1]

Sequence: Ac-WSNKSLEQIW-amide
Amount: 1mg
Catalog: BP12-117

$80.00

envelope glycoprotein fragment Acetyl/amide[Human immunodeficiency virus 1]

Sequence: Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-amide
Amount: 1mg
Catalog: BP12-118

$200.00

Envelope glycoprotein [Human immunodeficiency virus type 1]

Sequence: H2N-SLWNWFDITKWLWYIK-OH
Amount: 1mg
Catalog: BP10-350

$80.00

Envelope glycoprotein [Human immunodeficiency virus type 1] (187-203) Biotinyl/amide

Sequence: LCBiot-RGPGRAFVTIGKIGNMR-amide
Amount: 1mg
Catalog: BP10-355

$120.00