Bioactive peptides

NEP offers thousands of high quality, high purity bioactive peptides.  All of our bioactive peptides have gone through rigorous testing and include HPLC purities of >95% and Mass Spectral analysis.  Below is an alphabetical list of all of our bioactive peptides. 

To search use the search box (upper right):

BY KEYWORD: enter a keyword, example:  "Beta Amyloid" or "MOG"

BY PEPTIDE SEQUENCE:  enter peptide sequence or sequence fragment in 1 letter code, example:  "DAEF"

BY CATALOG NUMBER:  enter catalog number

Sub Categories

Beta-Amyloid Peptides

Histone Peptides

Products

Antigen 85-B precursor (281-294) [Multiple species]

Sequence: H2N-QDAYNAAGGHNAVF-OH
Amount: 1mg
Catalog: BP12-032

$80.00

AP1GBP1 fragment Acetyl/amide [Homo sapiens]

Sequence: Ac-LADDFGEFSLFGE-amide
Amount: 1mg
Catalog: BP12-033

$120.00

Apelin (65-76) [Homo sapiens]

Sequence: H2N-QRPRLSHKGPMP-OH
Amount: 1mg
Catalog: BP10-090

$60.00

apelin (65-77) (N15-Arg 66) [Homo sapiens]/[Mus musculus]/[Bos taurus]

Sequence: H2N-QR^^PRLSHKGPMPF-OH
Amount: 1mg
Catalog: BP12-034

$120.00

apolipoprotein A1 precursor fragment [Homo sapiens]

Sequence: H2N-VKDLATVYVDVLK-OH
Amount: 1mg
Catalog: BP12-035

$80.00

apolipoprotein AI fragment [Homo sapiens]

Sequence: H2N-DEPPQSPW-OH
Amount: 1mg
Catalog: BP12-037

$80.00

apolipoprotein B-100 precursor fragment [Homo sapiens]

Sequence: H2N-HINIDQFVR-OH
Amount: 1mg
Catalog: BP12-038

$80.00

apolipoprotein L1 fragment [Homo sapiens]

Sequence: H2N-ILQADQEL-OH
Amount: 1mg
Catalog: BP12-039

$80.00

Arg-Ala-Ala-Val-Lys Acetyl/amide 5-mer

Sequence: Ac-RAAVK-amide
Amount: 1mg
Catalog: BP12-040

$80.00

Arg-Arg-Arg-Lys Acetyl/amide 4-mer

Sequence: Ac-RRRK-amide
Amount: 1mg
Catalog: BP12-041

$80.00

Arg-Arg-Lys-Arg Acetyl/amide 4-mer

Sequence: Ac-RRKR-amide
Amount: 1mg
Catalog: BP12-042

$80.00

Arg-Gly-Arg 3-mer

Sequence: H2N-RGR-OH
Amount: 1mg
Catalog: BP12-043

$80.00

Arg-Gly-Asp 3-mer

Sequence: H2N-RGD-OH
Amount: 1mg
Catalog: BP12-044

$80.00

Asn-Gly-Asn 3-mer

Sequence: H2N-NGN-OH
Amount: 1mg
Catalog: BP12-045

$80.00

Asp-Glu-pTyr-Leu 4-mer

Sequence: H2N-DE(pY)L-OH
Amount: 1mg
Catalog: BP12-046

$120.00

Asp-Gly-Asp 3-mer

Sequence: H2N-DGD-OH
Amount: 1mg
Catalog: BP12-047

$80.00

ATPase, H+/K+ transporting, alpha polypeptide (885-902) Biotinyl [Rattus norvegicus]

Sequence: LCBiot-EGWFPLLCVGLRPQWEDH-OH
Amount: 1mg
Catalog: BP10-095

$160.00

baculoviral IAP repeat-containing protein 5 (95-104) [Homo sapiens]

Sequence: H2N-ELTLGEFLKL-OH
Amount: 1mg
Catalog: BP12-407

$80.00

baculoviral IAP repeat-containing protein 5 fragment [Homo sapiens]

Sequence: H2N-LMLGEFLKL-OH
Amount: 1mg
Catalog: BP12-405

$80.00

Bak protein (72-87) acetyl/amide [Homo sapiens]

Sequence: Ac-GQVGRQLAIIGDDINR-amide
Amount: 1mg
Catalog: BP10-100

$120.00

BAT3 (340-347) [Homo sapiens]

Sequence: H2N-APAQNPEL-OH
Amount: 1mg
Catalog: BP10-125

$40.00

Bcl-associated death promoter (128-142) 5FAM/amide [Mus musculus]

Sequence: 5FAM-(bA)SPFRGRSRSAPPNLW-amide
Amount: 1mg
Catalog: BP10-130

$200.00

Beta casein fragement [Ovis aries]/[Capra hircus]/[Bos taurus]

Sequence: H2N-FQSEEQQQTEDELQDK-OH
Amount: 1mg
Catalog: BP10-135

$80.00

Beta casein phospho fragement (pSer) [Ovis aries]/[Capra hircus]/[Bos taurus]

Sequence: H2N-FQ(pS)EEQQQTEDELQDK-OH
Amount: 1mg
Catalog: BP10-140

$160.00

Beta-Amyloid (1-10)

Sequence: H2N-DAEFRHDSGY-OH
Amount: 1mg
Catalog: BP17-055

$100.00

Beta-Amyloid (1-10) Cys/Amide

Sequence: H2N-DAEFRHDSGYC-amide
Amount: 1mg
Catalog: BP17-060

$100.00

Beta-Amyloid (1-11) Biotin

Sequence: LCBiot-DAEFRHDSGYE-OH
Amount: 1mg
Catalog: BP17-065

$120.00

Beta-Amyloid (1-15)

Sequence: H2N-DAEFRHDSGYEVHHQ-OH
Amount: 1mg
Catalog: BP17-070

$100.00

Beta-Amyloid (1-15) Biotin

Sequence: LCBiot-DAEFRHDSGYEVHHQ-OH
Amount: 1mg
Catalog: BP17-075

$120.00

Beta-Amyloid (1-16) Cys

Sequence: H2N-CDAEFRHDSGYEVHHQK-OH
Amount: 1mg
Catalog: BP17-080

$100.00

Beta-Amyloid (1-16) Cys [Mus musculus]

Sequence: H2N-CDAEFGHDSGFEVRHQK-OH
Amount: 1mg
Catalog: BP17-085

$100.00

Beta-Amyloid (1-16) Cys/E11Q/Acetyl

Sequence: Ac-DAEFRHDSGYQVHHQKC-OH
Amount: 1mg
Catalog: BP17-090

$100.00

Beta-Amyloid (1-17) Biotin

Sequence: LCBiot-DAEFRHDSGYEVHHQKL-OH
Amount: 1mg
Catalog: BP17-095

$150.00

Beta-Amyloid (1-17) Cys

Sequence: H2N-DAEFRHDSGYEVHHQKLC-OH
Amount: 1mg
Catalog: BP17-100

$125.00

Beta-Amyloid (1-18)

Sequence: H2N-DAEFRHDSGYEVHHQKLV-OH
Amount: 1mg
Catalog: BP17-105

$125.00

Beta-Amyloid (1-27) Biotin/5FAM

Sequence: 5Fam-DAEFRHDSGYEVHHQKLVFFAEDVGSN(KLCBiot)-amide
Amount: 1mg
Catalog: BP17-110

$250.00

Beta-Amyloid (1-28) Cys

Sequence: H2N-CDAEFRHDSGYEVHHQKLVFFAEDVGSNK-OH
Amount: 1mg
Catalog: BP17-115

$250.00

Beta-Amyloid (1-30) 6 Lys tag

Sequence: H2N-KKKKKKDAEFRHDSGYEVHHQKLVFFAEDVGSNKGA-OH
Amount: 1mg
Catalog: BP17-120

$250.00

Beta-Amyloid (1-30) V18E/F19E/6 Lys tag

Sequence: H2N-KKKKKKDAEFRHDSGYEVHHQKLEEFAEDVGSNKGA-OH
Amount: 1mg
Catalog: BP17-125

$250.00

Beta-Amyloid (1-38) Cys

Sequence: H2N-CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG-OH
Amount: 1mg
Catalog: BP17-135

$250.00

Beta-Amyloid (1-39)

Sequence: H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH
Amount: 1mg
Catalog: BP17-140

$250.00

Beta-Amyloid (1-39) Biotin/5FAM

Sequence: 5Fam-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV(KLCBiot)-amide
Amount: 1mg
Catalog: BP17-145

$300.00

Beta-Amyloid (1-4)

Sequence: H2N-DAEF-OH
Amount: 1mg
Catalog: BP17-005

$100.00

Beta-Amyloid (1-40)

Sequence: H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
Amount: 1mg
Catalog: BP17-150

$250.00

Beta-Amyloid (1-40) Biotin

Sequence: H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV(KLCBiot)-amide
Amount: 1mg
Catalog: BP17-155

$300.00

Beta-Amyloid (1-40) Biotin/5FAM

Sequence: 5Fam-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV(KLCBiot)-amide
Amount: 0.5mg NET
Catalog: BP17-160

$399.00

Beta-Amyloid (1-40) D23N

Sequence: H2N-DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV-OH
Amount: 1mg
Catalog: BP17-165

$300.00

Beta-Amyloid (1-40) E22Q

Sequence: H2N-DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV-OH
Amount: 1mg
Catalog: BP17-170

$300.00

Beta-Amyloid (1-42)

Sequence: H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Amount: 1mg
Catalog: BP17-175

$250.00

Beta-Amyloid (1-5) Acetyl/Aminohexanoic acid/amide

Sequence: Ac-DAEFR(Ahx)C-amide
Amount: 1mg
Catalog: BP17-010

$120.00

Beta-Amyloid (1-5) Aminohexanoic acid/amide

Sequence: H2N-DAEFR(Ahx)C-amide
Amount: 1mg
Catalog: BP17-015

$120.00

Beta-Amyloid (1-6)

Sequence: H2N-DAEFRH-OH
Amount: 1mg
Catalog: BP17-020

$100.00

Beta-Amyloid (1-7)

Sequence: H2N-DAEFRHD-OH
Amount: 1mg
Catalog: BP17-025

$80.00