Beta-Amyloid Peptides

Products

Beta-Amyloid (1-10)

Sequence: H2N-DAEFRHDSGY-OH
Amount: 1mg
Catalog: BP17-055

$100.00

Beta-Amyloid (1-10) Cys/Amide

Sequence: H2N-DAEFRHDSGYC-amide
Amount: 1mg
Catalog: BP17-060

$100.00

Beta-Amyloid (1-11) Biotin

Sequence: LCBiot-DAEFRHDSGYE-OH
Amount: 1mg
Catalog: BP17-065

$120.00

Beta-Amyloid (1-15)

Sequence: H2N-DAEFRHDSGYEVHHQ-OH
Amount: 1mg
Catalog: BP17-070

$100.00

Beta-Amyloid (1-15) Biotin

Sequence: LCBiot-DAEFRHDSGYEVHHQ-OH
Amount: 1mg
Catalog: BP17-075

$120.00

Beta-Amyloid (1-16) Cys

Sequence: H2N-CDAEFRHDSGYEVHHQK-OH
Amount: 1mg
Catalog: BP17-080

$100.00

Beta-Amyloid (1-16) Cys [Mus musculus]

Sequence: H2N-CDAEFGHDSGFEVRHQK-OH
Amount: 1mg
Catalog: BP17-085

$100.00

Beta-Amyloid (1-16) Cys/E11Q/Acetyl

Sequence: Ac-DAEFRHDSGYQVHHQKC-OH
Amount: 1mg
Catalog: BP17-090

$100.00

Beta-Amyloid (1-17) Biotin

Sequence: LCBiot-DAEFRHDSGYEVHHQKL-OH
Amount: 1mg
Catalog: BP17-095

$150.00

Beta-Amyloid (1-17) Cys

Sequence: H2N-DAEFRHDSGYEVHHQKLC-OH
Amount: 1mg
Catalog: BP17-100

$125.00

Beta-Amyloid (1-18)

Sequence: H2N-DAEFRHDSGYEVHHQKLV-OH
Amount: 1mg
Catalog: BP17-105

$125.00

Beta-Amyloid (1-27) Biotin/5FAM

Sequence: 5Fam-DAEFRHDSGYEVHHQKLVFFAEDVGSN(KLCBiot)-amide
Amount: 1mg
Catalog: BP17-110

$250.00

Beta-Amyloid (1-28) Cys

Sequence: H2N-CDAEFRHDSGYEVHHQKLVFFAEDVGSNK-OH
Amount: 1mg
Catalog: BP17-115

$250.00

Beta-Amyloid (1-30) 6 Lys tag

Sequence: H2N-KKKKKKDAEFRHDSGYEVHHQKLVFFAEDVGSNKGA-OH
Amount: 1mg
Catalog: BP17-120

$250.00

Beta-Amyloid (1-30) V18E/F19E/6 Lys tag

Sequence: H2N-KKKKKKDAEFRHDSGYEVHHQKLEEFAEDVGSNKGA-OH
Amount: 1mg
Catalog: BP17-125

$250.00

Beta-Amyloid (1-38) Cys

Sequence: H2N-CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG-OH
Amount: 1mg
Catalog: BP17-135

$250.00

Beta-Amyloid (1-39)

Sequence: H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH
Amount: 1mg
Catalog: BP17-140

$250.00

Beta-Amyloid (1-39) Biotin/5FAM

Sequence: 5Fam-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV(KLCBiot)-amide
Amount: 1mg
Catalog: BP17-145

$300.00

Beta-Amyloid (1-4)

Sequence: H2N-DAEF-OH
Amount: 1mg
Catalog: BP17-005

$100.00

Beta-Amyloid (1-40)

Sequence: H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
Amount: 1mg
Catalog: BP17-150

$250.00

Beta-Amyloid (1-40) Biotin

Sequence: H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV(KLCBiot)-amide
Amount: 1mg
Catalog: BP17-155

$300.00

Beta-Amyloid (1-40) Biotin/5FAM

Sequence: 5Fam-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV(KLCBiot)-amide
Amount: 0.5mg NET
Catalog: BP17-160

$399.00

Beta-Amyloid (1-40) D23N

Sequence: H2N-DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV-OH
Amount: 1mg
Catalog: BP17-165

$300.00

Beta-Amyloid (1-40) E22Q

Sequence: H2N-DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV-OH
Amount: 1mg
Catalog: BP17-170

$300.00

Beta-Amyloid (1-42)

Sequence: H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Amount: 1mg
Catalog: BP17-175

$250.00

Beta-Amyloid (1-5) Acetyl/Aminohexanoic acid/amide

Sequence: Ac-DAEFR(Ahx)C-amide
Amount: 1mg
Catalog: BP17-010

$120.00

Beta-Amyloid (1-5) Aminohexanoic acid/amide

Sequence: H2N-DAEFR(Ahx)C-amide
Amount: 1mg
Catalog: BP17-015

$120.00

Beta-Amyloid (1-6)

Sequence: H2N-DAEFRH-OH
Amount: 1mg
Catalog: BP17-020

$100.00

Beta-Amyloid (1-7)

Sequence: H2N-DAEFRHD-OH
Amount: 1mg
Catalog: BP17-025

$80.00

Beta-Amyloid (1-8) Cys

Sequence: H2N-DAEFRHDS(Ahx)C-OH
Amount: 1mg
Catalog: BP17-030

$120.00

Beta-Amyloid (1-8) Cys

Sequence: H2N-DAEFRHDSC-OH
Amount: 1mg
Catalog: BP17-035

$100.00

Beta-Amyloid (1-8) Cys/Lys

Sequence: H2N-KMDAEFRHDSC-OH
Amount: 1mg
Catalog: BP17-040

$100.00

Beta-Amyloid (1-8) Lysine

Sequence: H2N-KDAEFRHDS-OH
Amount: 1mg
Catalog: BP17-045

$100.00

Beta-Amyloid (1-9) Biotin/Amide

Sequence: H2N-DAEFRHDSG(KLCBiot)-amide
Amount: 1mg
Catalog: BP17-050

$120.00

Beta-Amyloid (10-15) Cys

Sequence: H2N-CYEVHHQ-OH
Amount: 1mg
Catalog: BP17-245

$100.00

Beta-Amyloid (10-16) Cys

Sequence: H2N-CYEVHHQK-OH
Amount: 1mg
Catalog: BP17-250

$100.00

Beta-Amyloid (10-17) Cys

Sequence: H2N-CYEVHHQKL-OH
Amount: 1mg
Catalog: BP17-255

$100.00

Beta-Amyloid (10-18)

Sequence: H2N-YEVHHQKLV-OH
Amount: 1mg
Catalog: BP17-260

$100.00

Beta-Amyloid (10-18) Cys

Sequence: H2N-CYEVHHQKLV-OH
Amount: 1mg
Catalog: BP17-265

$100.00

Beta-Amyloid (10-19)

Sequence: H2N-YEVHHQKLVF-OH
Amount: 1mg
Catalog: BP17-270

$100.00

Beta-Amyloid (11-16) Cys

Sequence: H2N-C(Ahx)EVHHQK-OH
Amount: 1mg
Catalog: BP17-275

$120.00

Beta-Amyloid (11-18) Cys

Sequence: H2N-C(Ahx)EVHHQKLV-OH
Amount: 1mg
Catalog: BP17-280

$120.00

Beta-Amyloid (11-18) E11-pGlu

Sequence: pE-VHHQKLVC-amide
Amount: 1mg
Catalog: BP17-285

$120.00

Beta-Amyloid (11-20)

Sequence: H2N-EVHHQKLVFF-OH
Amount: 1mg
Catalog: BP17-290

$100.00

Beta-Amyloid (11-40)

Sequence: H2N-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
Amount: 1mg
Catalog: BP17-295

$150.00

Beta-Amyloid (12-19) Cys

Sequence: H2N-CHHQKLVFF-OH
Amount: 1mg
Catalog: BP17-300

$100.00

Beta-Amyloid (13-20) Cys

Sequence: H2N-HHQKLVFFC-OH
Amount: 1mg
Catalog: BP17-305

$100.00

Beta-Amyloid (13-22)

Sequence: H2N-HHQKLVFFAE-OH
Amount: 1mg
Catalog: BP17-310

$100.00

Beta-Amyloid (13-28) Cys

Sequence: H2N-HHQKLVFFAEDVGSNKC-OH
Amount: 1mg
Catalog: BP17-315

$120.00

Beta-Amyloid (16-35) Biotin/Lysine

Sequence: LCBiot-KLVFFAEDVGSNKGAIIGLMK-OH
Amount: 1mg
Catalog: BP17-320

$150.00

Beta-Amyloid (16-35) G29H/G33E

Sequence: H2N-KLVFFAEDVGSNKHAIIELMK-OH
Amount: 1mg
Catalog: BP17-330

$120.00

Beta-Amyloid (16-35) Lysine/Amide

Sequence: H2N-KLVFFAEDVGSNKGAIIGLMK-amide
Amount: 1mg
Catalog: BP17-325

$120.00

Beta-Amyloid (17-31)

Sequence: H2N-LVFFAEDVGSNKGAI-OH
Amount: 1mg
Catalog: BP17-335

$100.00